Lineage for d1ctj__ (1ctj -)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45011Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 45012Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 45013Family a.3.1.1: monodomain cytochrome c [46627] (11 proteins)
  6. 45094Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (9 species)
  7. 45114Species Monoraphidium braunii [TaxId:34112] [46630] (3 PDB entries)
  8. 45115Domain d1ctj__: 1ctj - [15798]

Details for d1ctj__

PDB Entry: 1ctj (more details), 1.1 Å

PDB Description: crystal structure of cytochrome c6

SCOP Domain Sequences for d1ctj__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ctj__ a.3.1.1 (-) Cytochrome c6 (synonym: cytochrome c553) {Monoraphidium braunii}
eadlalgkavfdgncaachagggnnvipdhtlqkaaieqfldggfnieaivyqiengkga
mpawdgrldedeiagvaayvydqaagnkw

SCOP Domain Coordinates for d1ctj__:

Click to download the PDB-style file with coordinates for d1ctj__.
(The format of our PDB-style files is described here.)

Timeline for d1ctj__: