Lineage for d3e0wa3 (3e0w A:358-498)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1371047Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 1371048Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families) (S)
  5. 1371049Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)
    automatically mapped to Pfam PF02887
  6. 1371050Protein Pyruvate kinase, C-terminal domain [52937] (6 species)
  7. 1371138Species Trypanosome (Leishmania mexicana) [TaxId:5665] [52940] (11 PDB entries)
  8. 1371179Domain d3e0wa3: 3e0w A:358-498 [157968]
    Other proteins in same PDB: d3e0wa1, d3e0wa2
    automatically matched to d1pkla3

Details for d3e0wa3

PDB Entry: 3e0w (more details), 3.1 Å

PDB Description: crystal structure of pyruvate kinase from leishmania mexicana
PDB Compounds: (A:) pyruvate kinase

SCOPe Domain Sequences for d3e0wa3:

Sequence, based on SEQRES records: (download)

>d3e0wa3 c.49.1.1 (A:358-498) Pyruvate kinase, C-terminal domain {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
neyvffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncp
ivcvttrlqtcrqlnitqgvesvffdadklghdwgkehrvaagvefakskgyvqtgdycv
vihadhkvkgyanqtrillve

Sequence, based on observed residues (ATOM records): (download)

>d3e0wa3 c.49.1.1 (A:358-498) Pyruvate kinase, C-terminal domain {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
neyvffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncp
ivcvttrlqtcrqlnitqgvesvffdadklghdwgkehrvaagvefakskgyvqtgdycv
vihadnqtrillve

SCOPe Domain Coordinates for d3e0wa3:

Click to download the PDB-style file with coordinates for d3e0wa3.
(The format of our PDB-style files is described here.)

Timeline for d3e0wa3: