Lineage for d3e0wa2 (3e0w A:7-87,A:187-357)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 818190Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (7 families) (S)
  5. 818191Family c.1.12.1: Pyruvate kinase [51622] (1 protein)
  6. 818192Protein Pyruvate kinase, N-terminal domain [51623] (6 species)
    this domain is interrupted by an all-beta domain
    C-terminal domain is alpha/beta
  7. 818230Species Leishmania mexicana [TaxId:5665] [51626] (3 PDB entries)
  8. 818239Domain d3e0wa2: 3e0w A:7-87,A:187-357 [157967]
    Other proteins in same PDB: d3e0wa1, d3e0wa3
    automatically matched to d1pkla2
    mutant

Details for d3e0wa2

PDB Entry: 3e0w (more details), 3.1 Å

PDB Description: Crystal structure of pyruvate kinase from Leishmania mexicana
PDB Compounds: (A:) pyruvate kinase

SCOP Domain Sequences for d3e0wa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e0wa2 c.1.12.1 (A:7-87,A:187-357) Pyruvate kinase, N-terminal domain {Leishmania mexicana [TaxId: 5665]}
ltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsheyhqttinn
vrqaaaelgvniaialdtkgpXpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrk
algpkgrdimiickienhqgvqnidsiieesdgimvargdlgveipaekvvvaqkilisk
cnvagkpvicatqmlesmtynprptraevsdvanavfngadcvmlsgetakgkypnevvq
ymaricleaqsal

SCOP Domain Coordinates for d3e0wa2:

Click to download the PDB-style file with coordinates for d3e0wa2.
(The format of our PDB-style files is described here.)

Timeline for d3e0wa2: