SCOPe 2.05: Domain d3e0wa1: 3e0w A:88-186

Lineage for d3e0wa1 (3e0w A:88-186)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
   barrel, closed; n=7, S=10; complex topology

4. Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families)

5. Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
   this domain interrupts beta/alpha-barrel domain
   C-terminal domain is alpha/beta

6. Protein Pyruvate kinase (PK) [50802] (6 species)

7. Species Trypanosome (Leishmania mexicana) [TaxId:5665] [50805] (11 PDB entries)

8. Domain d3e0wa1: 3e0w A:88-186 [157966]
   Other proteins in same PDB: d3e0wa2, d3e0wa3
   automatically matched to d1pkla1

Details for d3e0wa1

PDB Entry: 3e0w, 3.1 Å

PDB Description: Crystal structure of pyruvate kinase from Leishmania mexicana

PDB Compounds: (A:) pyruvate kinase

SCOPe Domain Sequences for d3e0wa1:

Sequence; same for both SEQRES and ATOM records:

>d3e0wa1 b.58.1.1 (A:88-186) Pyruvate kinase (PK) {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
eirtgqfvggdavmergatcyvttdpafadkgtkdkfyidyqnlskvvrpgnyiyiddgi
lilqvqshedeqtlectvtnshtisdrrgvnlpgcdvdl

Timeline for d3e0wa1:

• d3e0wa1 first appeared in SCOP 1.75
  
• d3e0wa1 appears in SCOPe 2.04
  
• d3e0wa1 appears in SCOPe 2.06
  
• d3e0wa1 appears in the current release, SCOPe 2.07