Lineage for d3e0vf3 (3e0v F:358-498)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1371047Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 1371048Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families) (S)
  5. 1371049Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)
    automatically mapped to Pfam PF02887
  6. 1371050Protein Pyruvate kinase, C-terminal domain [52937] (6 species)
  7. 1371138Species Trypanosome (Leishmania mexicana) [TaxId:5665] [52940] (11 PDB entries)
  8. 1371185Domain d3e0vf3: 3e0v F:358-498 [157965]
    Other proteins in same PDB: d3e0va1, d3e0va2, d3e0vb1, d3e0vb2, d3e0vc1, d3e0vc2, d3e0vd1, d3e0vd2, d3e0ve1, d3e0ve2, d3e0vf1, d3e0vf2
    automatically matched to d1pkla3
    complexed with gol, so4

Details for d3e0vf3

PDB Entry: 3e0v (more details), 3.3 Å

PDB Description: crystal structure of pyruvate kinase from leishmania mexicana in complex with sulphate ions
PDB Compounds: (F:) pyruvate kinase

SCOPe Domain Sequences for d3e0vf3:

Sequence, based on SEQRES records: (download)

>d3e0vf3 c.49.1.1 (F:358-498) Pyruvate kinase, C-terminal domain {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
neyvffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncp
ivcvttrlqtcrqlnitqgvesvffdadklghdwgkehrvaagvefakskgyvqtgdycv
vihadhkvkgyanqtrillve

Sequence, based on observed residues (ATOM records): (download)

>d3e0vf3 c.49.1.1 (F:358-498) Pyruvate kinase, C-terminal domain {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
neyvffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncp
ivcvttrlqtcrqlnitqgvesvffdadklghdwgkehrvaagvefakskgyvqtgdycv
vihadanqtrillve

SCOPe Domain Coordinates for d3e0vf3:

Click to download the PDB-style file with coordinates for d3e0vf3.
(The format of our PDB-style files is described here.)

Timeline for d3e0vf3: