Lineage for d3e0vf2 (3e0v F:0-87,F:187-357)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2837913Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2837914Family c.1.12.1: Pyruvate kinase [51622] (1 protein)
  6. 2837915Protein Pyruvate kinase, N-terminal domain [51623] (6 species)
    this domain is interrupted by an all-beta domain
    C-terminal domain is alpha/beta
  7. 2838018Species Trypanosome (Leishmania mexicana) [TaxId:5665] [51626] (11 PDB entries)
  8. 2838061Domain d3e0vf2: 3e0v F:0-87,F:187-357 [157964]
    Other proteins in same PDB: d3e0va1, d3e0va3, d3e0va4, d3e0vb1, d3e0vb3, d3e0vb4, d3e0vc1, d3e0vc3, d3e0vc4, d3e0vd1, d3e0vd3, d3e0vd4, d3e0ve1, d3e0ve3, d3e0ve4, d3e0vf1, d3e0vf3, d3e0vf4
    automatically matched to d1pkla2
    complexed with gol, so4

Details for d3e0vf2

PDB Entry: 3e0v (more details), 3.3 Å

PDB Description: crystal structure of pyruvate kinase from leishmania mexicana in complex with sulphate ions
PDB Compounds: (F:) pyruvate kinase

SCOPe Domain Sequences for d3e0vf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e0vf2 c.1.12.1 (F:0-87,F:187-357) Pyruvate kinase, N-terminal domain {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
msqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgshey
hqttinnvrqaaaelgvniaialdtkgpXpavsakdrvdlqfgveqgvdmifasfirsae
qvgdvrkalgpkgrdimiickienhqgvqnidsiieesdgimvargdlgveipaekvvva
qkiliskcnvagkpvicatqmlesmtynprptraevsdvanavfngadcvmlsgetakgk
ypnevvqymaricleaqsal

SCOPe Domain Coordinates for d3e0vf2:

Click to download the PDB-style file with coordinates for d3e0vf2.
(The format of our PDB-style files is described here.)

Timeline for d3e0vf2: