Lineage for d1c75a_ (1c75 A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45011Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 45012Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 45013Family a.3.1.1: monodomain cytochrome c [46627] (11 proteins)
  6. 45094Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (9 species)
  7. 45097Species Bacillus pasteurii [TaxId:1474] [46629] (2 PDB entries)
  8. 45098Domain d1c75a_: 1c75 A: [15796]

Details for d1c75a_

PDB Entry: 1c75 (more details), 0.97 Å

PDB Description: 0.97 a "ab initio" crystal structure of cytochrome c-553 from bacillus pasteurii

SCOP Domain Sequences for d1c75a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c75a_ a.3.1.1 (A:) Cytochrome c6 (synonym: cytochrome c553) {Bacillus pasteurii}
vdaeavvqqkcischggdltgasapaidkaganyseeeildiilngqggmpggiakgaea
eavaawlaekk

SCOP Domain Coordinates for d1c75a_:

Click to download the PDB-style file with coordinates for d1c75a_.
(The format of our PDB-style files is described here.)

Timeline for d1c75a_: