SCOPe 2.07: Domain d1c75a_: 1c75 A:

Lineage for d1c75a_ (1c75 A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 protein domains)

6. Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (10 species)

7. Species Bacillus pasteurii [TaxId:1474] [46629] (5 PDB entries)

8. Domain d1c75a_: 1c75 A: [15796]
   complexed with hem

Details for d1c75a_

PDB Entry: 1c75, 0.97 Å

PDB Description: 0.97 a "ab initio" crystal structure of cytochrome c-553 from bacillus pasteurii

PDB Compounds: (A:) cytochrome c-553

SCOPe Domain Sequences for d1c75a_:

Sequence; same for both SEQRES and ATOM records:

>d1c75a_ a.3.1.1 (A:) Cytochrome c6 (synonym: cytochrome c553) {Bacillus pasteurii [TaxId: 1474]}
vdaeavvqqkcischggdltgasapaidkaganyseeeildiilngqggmpggiakgaea
eavaawlaekk

Timeline for d1c75a_:

• d1c75a_ first appeared (with stable ids) in SCOP 1.55
  
• d1c75a_ appears in SCOPe 2.06