| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
| Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
| Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (11 species) |
| Species Bacillus pasteurii [TaxId:1474] [46629] (6 PDB entries) |
| Domain d1c75a_: 1c75 A: [15796] complexed with hec |
PDB Entry: 1c75 (more details), 0.97 Å
SCOPe Domain Sequences for d1c75a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c75a_ a.3.1.1 (A:) Cytochrome c6 (synonym: cytochrome c553) {Bacillus pasteurii [TaxId: 1474]}
vdaeavvqqkcischggdltgasapaidkaganyseeeildiilngqggmpggiakgaea
eavaawlaekk
Timeline for d1c75a_: