Class b: All beta proteins [48724] (174 folds) |
Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily) barrel, closed; n=7, S=10; complex topology |
Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) |
Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein) this domain interrupts beta/alpha-barrel domain C-terminal domain is alpha/beta |
Protein Pyruvate kinase (PK) [50802] (6 species) |
Species Trypanosome (Leishmania mexicana) [TaxId:5665] [50805] (3 PDB entries) |
Domain d3e0vb1: 3e0v B:88-186 [157951] Other proteins in same PDB: d3e0va2, d3e0va3, d3e0vb2, d3e0vb3, d3e0vc2, d3e0vc3, d3e0vd2, d3e0vd3, d3e0ve2, d3e0ve3, d3e0vf2, d3e0vf3 automatically matched to d1pkla1 complexed with gol, so4 |
PDB Entry: 3e0v (more details), 3.3 Å
SCOPe Domain Sequences for d3e0vb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e0vb1 b.58.1.1 (B:88-186) Pyruvate kinase (PK) {Trypanosome (Leishmania mexicana) [TaxId: 5665]} eirtgqfvggdavmergatcyvttdpafadkgtkdkfyidyqnlskvvrpgnyiyiddgi lilqvqshedeqtlectvtnshtisdrrgvnlpgcdvdl
Timeline for d3e0vb1: