SCOPe 2.06: Domain d3dysa_: 3dys A:

Lineage for d3dysa_ (3dys A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.2: PDEase [48548] (7 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A [109942] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [109943] (20 PDB entries)
   Uniprot O76083 241-566

8. Domain d3dysa_: 3dys A: [157946]
   Other proteins in same PDB: d3dysb3
   automated match to d2hd1a1
   complexed with 5gp, fmt, ibm, mg, mn

Details for d3dysa_

PDB Entry: 3dys, 2.3 Å

PDB Description: human phosphodiestrase-5'GMP complex (EP), produced by soaking with 20mM cGMP+20 mM MnCl2+20 mM MgCl2 for 2 hours, and flash-cooled to liquid nitrogen temperature when substrate was still abudant.

PDB Compounds: (A:) High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A

SCOPe Domain Sequences for d3dysa_:

Sequence; same for both SEQRES and ATOM records:

>d3dysa_ a.211.1.2 (A:) High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A {Human (Homo sapiens) [TaxId: 9606]}
typkyllspetiealrkptfdvwlwepnemlsclehmyhdlglvrdfsinpvtlrrwlfc
vhdnyrnnpfhnfrhcfcvaqmmysmvwlcslqekfsqtdililmtaaichdldhpgynn
tyqinartelavryndisplenhhcavafqilaepecnifsnippdgfkqirqgmitlil
atdmarhaeimdsfkekmenfdysneehmtllkmilikccdisnevrpmevaepwvdcll
eeyfmqsdrekseglpvapfmdrdkvtkataqigfikfvlipmfetvtklfpmveeimlq
plwesrdryeelkriddamkelqk

Timeline for d3dysa_:

• d3dysa_ first appeared in SCOP 1.75, called d3dysa1
  
• d3dysa_ appears in SCOPe 2.05
  
• d3dysa_ appears in SCOPe 2.07
  
• d3dysa_ appears in the current release, SCOPe 2.08