SCOP 1.75: Domain d3dyqa1: 3dyq A:182-505

Lineage for d3dyqa1 (3dyq A:182-505)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (5 families)

5. Family a.211.1.2: PDEase [48548] (6 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A [109942] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [109943] (7 PDB entries)
   Uniprot O76083 241-566

8. Domain d3dyqa1: 3dyq A:182-505 [157944]
   automatically matched to d2hd1a1
   complexed with ibm, na, pcg

Details for d3dyqa1

PDB Entry: 3dyq, 2.5 Å

PDB Description: human phosphodiestrase 9 (inhibited by omitting divalent cation) in complex with cGMP

PDB Compounds: (A:) High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A

SCOP Domain Sequences for d3dyqa1:

Sequence; same for both SEQRES and ATOM records:

>d3dyqa1 a.211.1.2 (A:182-505) High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A {Human (Homo sapiens) [TaxId: 9606]}
typkyllspetiealrkptfdvwlwepnemlsclehmyhdlglvrdfsinpvtlrrwlfc
vhdnyrnnpfhnfrhcfcvaqmmysmvwlcslqekfsqtdililmtaaichdldhpgynn
tyqinartelavryndisplenhhcavafqilaepecnifsnippdgfkqirqgmitlil
atdmarhaeimdsfkekmenfdysneehmtllkmilikccdisnevrpmevaepwvdcll
eeyfmqsdrekseglpvapfmdrdkvtkataqigfikfvlipmfetvtklfpmveeimlq
plwesrdryeelkriddamkelqk

Timeline for d3dyqa1:

• d3dyqa1 is new in SCOP 1.75
  
• d3dyqa1 is called d3dyqa_ in SCOPe 2.01
  
• d3dyqa1 appears in the current release, SCOPe 2.08, called d3dyqa2