Lineage for d1qnnc1 (1qnn C:1-84)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 811Fold a.2: Long alpha-hairpin [46556] (11 superfamilies)
  4. 895Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) (S)
  5. 896Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)
  6. 897Protein Cambialistic superoxide dismutase [46622] (2 species)
  7. 898Species Porphyromonas gingivalis [TaxId:837] [46624] (1 PDB entry)
  8. 901Domain d1qnnc1: 1qnn C:1-84 [15794]
    Other proteins in same PDB: d1qnna2, d1qnnb2, d1qnnc2, d1qnnd2

Details for d1qnnc1

PDB Entry: 1qnn (more details), 1.8 Å

PDB Description: cambialistic superoxide dismutase from porphyromonas gingivalis

SCOP Domain Sequences for d1qnnc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qnnc1 a.2.11.1 (C:1-84) Cambialistic superoxide dismutase {Porphyromonas gingivalis}
mthelislpyavdalapvisketvefhhgkhlktyvdnlnkliigtefenadlntivqks
eggifnnagqtlnhnlyftqfrpg

SCOP Domain Coordinates for d1qnnc1:

Click to download the PDB-style file with coordinates for d1qnnc1.
(The format of our PDB-style files is described here.)

Timeline for d1qnnc1: