| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily) core: 2 helices and adjacent loops |
Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) ![]() the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits |
| Family a.143.1.1: RNA polymerase omega subunit [63563] (2 proteins) 4 helices; irregular array |
| Protein RNA polymerase omega subunit [63564] (3 species) |
| Species Thermus thermophilus HB8 [TaxId:300852] [158241] (1 PDB entry) |
| Domain d3dxjo1: 3dxj O:2-96 [157932] Other proteins in same PDB: d3dxjc1, d3dxjd1, d3dxjm1, d3dxjn1 automatically matched to d1iw7e_ protein/DNA complex; protein/RNA complex; complexed with mg, mpd, ne6, po4, zn |
PDB Entry: 3dxj (more details), 3 Å
SCOPe Domain Sequences for d3dxjo1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dxjo1 a.143.1.1 (O:2-96) RNA polymerase omega subunit {Thermus thermophilus HB8 [TaxId: 300852]}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnae
twamkelltgrlvfgenlvpedrlqkemeriypge
Timeline for d3dxjo1: