SCOPe 2.03: Domain d3dxjo1: 3dxj O:2-96

Lineage for d3dxjo1 (3dxj O:2-96)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
   core: 2 helices and adjacent loops

4. Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families)
   the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits

5. Family a.143.1.1: RNA polymerase omega subunit [63563] (2 proteins)
   4 helices; irregular array

6. Protein RNA polymerase omega subunit [63564] (3 species)

7. Species Thermus thermophilus HB8 [TaxId:300852] [158241] (1 PDB entry)

8. Domain d3dxjo1: 3dxj O:2-96 [157932]
   Other proteins in same PDB: d3dxjc1, d3dxjd1, d3dxjm1, d3dxjn1
   automatically matched to d1iw7e_
   protein/DNA complex; protein/RNA complex; complexed with mg, mpd, ne6, po4, zn

Details for d3dxjo1

PDB Entry: 3dxj, 3 Å

PDB Description: Crystal structure of thermus thermophilus rna polymerase holoenzyme in complex with the antibiotic myxopyronin

PDB Compounds: (O:) bactrial RNA polymerase omega subunit; chain e, o

SCOPe Domain Sequences for d3dxjo1:

Sequence; same for both SEQRES and ATOM records:

>d3dxjo1 a.143.1.1 (O:2-96) RNA polymerase omega subunit {Thermus thermophilus HB8 [TaxId: 300852]}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnae
twamkelltgrlvfgenlvpedrlqkemeriypge

Timeline for d3dxjo1:

• d3dxjo1 first appeared in SCOP 1.75
  
• d3dxjo1 appears in SCOPe 2.02
  
• d3dxjo1 is called d3dxjo_ in SCOPe 2.04
  
• d3dxjo1 appears in the current release, SCOPe 2.08, called d3dxjo_