Lineage for d3dxjm1 (3dxj M:1-1119)

  1. Root: SCOP 1.75
  2. 883176Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 885463Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 885464Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 885465Family e.29.1.1: RNA-polymerase beta [64485] (2 proteins)
  6. 885498Protein RNA-polymerase beta [64488] (2 species)
  7. 885504Species Thermus thermophilus [TaxId:274] [75609] (13 PDB entries)
    Uniprot Q8RQE9; part of multichain biological unit
  8. 885520Domain d3dxjm1: 3dxj M:1-1119 [157930]
    Other proteins in same PDB: d3dxjd1, d3dxje1, d3dxjn1, d3dxjo1
    automatically matched to d1iw7c_
    complexed with mg, mpd, ne6, po4, zn

Details for d3dxjm1

PDB Entry: 3dxj (more details), 3 Å

PDB Description: Crystal structure of thermus thermophilus rna polymerase holoenzyme in complex with the antibiotic myxopyronin
PDB Compounds: (M:) bactrial RNA polymerase beta subunit; chain c, m

SCOP Domain Sequences for d3dxjm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dxjm1 e.29.1.1 (M:1-1119) RNA-polymerase beta {Thermus thermophilus [TaxId: 274]}
meikrfgrireviplpplteiqvesyrralqadvppekrenvgiqaafretfpieeedkg
kgglvldfleyrlgeppfpqdecrekdltyqaplyarlqlihkdtglikedevflghipl
mtedgsfiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidlevepng
vvsmkvnkrkfplvlllrvlgydqetlarelgaygelvqglmdesvfamrpeealirlft
llrpgdppkrdkavayvygliadprrydlgeagrykaeeklgirlsgrtlarfedgefkd
evflptlrylfaltagvpghevddidhlgnrrirtvgelmtdqfrvglarlargvrerml
mgsedsltpaklvnsrpleaaireffsrsqlsqfkdetnplsslrhkrrisalgpggltr
eragfdvrdvhrthygricpvetpeganiglitslaayarvdelgfirtpyrrvvggvvt
devvymtateedrytiaqantplegnriaaervvarrkgepvivspeevefmdvspkqvf
svntnlipflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeed
gevakvdgnrivvryedgrlveyplrrfyrsnqgtaldqrprvvvgqrvrkgdlladgpa
sengflalgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgpe
ritrdiphlseaalrdldeegvvrigaevkpgdilvgrtsfkgeseptpeerllrsifge
kardvkdtslrvppgeggivvrtvrlrrgdpgvelkpgvrevvrvyvaqkrklqvgdkla
nrhgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqr
yispifdgakepeikellaqafevyfgkrkgegfgvdkrevevlrraeklglvtpgktpe
eqlkelflqgkvvlydgrtgepiegpivvgqmfimklyhmvedkmharstgpyslitqqp
lggkaqfggqrfgemevwaleaygaahtlqemltlksddiegrnaayeaiikgedvpeps
vpesfrvlvkelqalaldvqtldekdnpvdifeglaskr

SCOP Domain Coordinates for d3dxjm1:

Click to download the PDB-style file with coordinates for d3dxjm1.
(The format of our PDB-style files is described here.)

Timeline for d3dxjm1: