Lineage for d3dxje_ (3dxj E:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1506616Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 1506617Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 1506618Family a.143.1.1: RNA polymerase omega subunit [63563] (2 proteins)
    4 helices; irregular array
  6. 1506619Protein RNA polymerase omega subunit [63564] (3 species)
  7. 1506624Species Thermus thermophilus HB8 [TaxId:300852] [158241] (6 PDB entries)
  8. 1506635Domain d3dxje_: 3dxj E: [157929]
    Other proteins in same PDB: d3dxjc_, d3dxjd_, d3dxjf1, d3dxjf2, d3dxjf3, d3dxjm_, d3dxjn_, d3dxjp1, d3dxjp2, d3dxjp3
    automated match to d1i6ve_
    protein/DNA complex; protein/RNA complex; complexed with mg, mpd, ne6, po4, zn

Details for d3dxje_

PDB Entry: 3dxj (more details), 3 Å

PDB Description: Crystal structure of thermus thermophilus rna polymerase holoenzyme in complex with the antibiotic myxopyronin
PDB Compounds: (E:) bactrial RNA polymerase omega subunit; chain e, o

SCOPe Domain Sequences for d3dxje_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dxje_ a.143.1.1 (E:) RNA polymerase omega subunit {Thermus thermophilus HB8 [TaxId: 300852]}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnae
twamkelltgrlvfgenlvpedrlqkemeriypge

SCOPe Domain Coordinates for d3dxje_:

Click to download the PDB-style file with coordinates for d3dxje_.
(The format of our PDB-style files is described here.)

Timeline for d3dxje_: