SCOPe 2.01: Domain d3dwyb_: 3dwy B:

Lineage for d3dwyb_ (3dwy B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.1: Bromodomain [47371] (5 proteins)

6. Protein automated matches [190366] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187201] (8 PDB entries)

8. Domain d3dwyb_: 3dwy B: [157926]
   automated match to d1jspb_
   complexed with edo

Details for d3dwyb_

PDB Entry: 3dwy, 1.98 Å

PDB Description: crystal structure of the bromodomain of human crebbp

PDB Compounds: (B:) creb-binding protein

SCOPe Domain Sequences for d3dwyb_:

Sequence; same for both SEQRES and ATOM records:

>d3dwyb_ a.29.2.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkldt
gqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqsl

Timeline for d3dwyb_:

• d3dwyb_ first appeared in SCOP 1.75, called d3dwyb1
  
• d3dwyb_ appears in SCOPe 2.02
  
• d3dwyb_ appears in the current release, SCOPe 2.08