![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
![]() | Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) ![]() |
![]() | Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
![]() | Protein Penicillin-binding protein 2, PBP2 [160970] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [160971] (3 PDB entries) Uniprot Q2YY56 293-692 |
![]() | Domain d3dwkd2: 3dwk D:293-692 [157920] Other proteins in same PDB: d3dwka1, d3dwkb1, d3dwkc1, d3dwkd1 automated match to d2olua2 complexed with lda, so4 |
PDB Entry: 3dwk (more details), 3.1 Å
SCOPe Domain Sequences for d3dwkd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dwkd2 e.3.1.1 (D:293-692) Penicillin-binding protein 2, PBP2 {Staphylococcus aureus [TaxId: 1280]} tnqdseynsyvnfvkselmnnkafkdenlgnvlqsgikiytnmdkdvqktlqndvdngsf yknkdqqvgatildsktgglvaisggrdfkdvvnrnqatdphptgsslkpflaygpaien mkwatnhaiqdessyqvdgstfrnydtkshgtvsiydalrqsfnipalkawqsvkqnagn dapkkfaaklglnyegdigpsevlggsasefsptqlasafaaianggtynnahsiqkvvt rdgetieydhtshkamsdytaymlaemlkgtfkpygsayghgvsgvnmgaktgtgtygae tysqynlpdnaakdvwingftpqytmsvwmgfskvkqygensfvghsqqeypqflyenvm skissrdgedfkrpssvsgsipsinvsgsqdnnttnrsth
Timeline for d3dwkd2: