SCOPe 2.04: Domain d3dwkc2: 3dwk C:293-692

Lineage for d3dwkc2 (3dwk C:293-692)

1. Root: SCOPe 2.04

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein Penicillin-binding protein 2, PBP2 [160970] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [160971] (3 PDB entries)
   Uniprot Q2YY56 293-692

8. Domain d3dwkc2: 3dwk C:293-692 [157918]
   Other proteins in same PDB: d3dwka1, d3dwkb1, d3dwkc1, d3dwkd1
   automated match to d2olua2
   complexed with lda, so4

Details for d3dwkc2

PDB Entry: 3dwk, 3.1 Å

PDB Description: identification of dynamic structural motifs involved in peptidoglycan glycosyltransfer

PDB Compounds: (C:) Penicillin-binding protein 2

SCOPe Domain Sequences for d3dwkc2:

Sequence; same for both SEQRES and ATOM records:

>d3dwkc2 e.3.1.1 (C:293-692) Penicillin-binding protein 2, PBP2 {Staphylococcus aureus [TaxId: 1280]}
tnqdseynsyvnfvkselmnnkafkdenlgnvlqsgikiytnmdkdvqktlqndvdngsf
yknkdqqvgatildsktgglvaisggrdfkdvvnrnqatdphptgsslkpflaygpaien
mkwatnhaiqdessyqvdgstfrnydtkshgtvsiydalrqsfnipalkawqsvkqnagn
dapkkfaaklglnyegdigpsevlggsasefsptqlasafaaianggtynnahsiqkvvt
rdgetieydhtshkamsdytaymlaemlkgtfkpygsayghgvsgvnmgaktgtgtygae
tysqynlpdnaakdvwingftpqytmsvwmgfskvkqygensfvghsqqeypqflyenvm
skissrdgedfkrpssvsgsipsinvsgsqdnnttnrsth

Timeline for d3dwkc2:

• d3dwkc2 first appeared in SCOP 1.75
  
• d3dwkc2 appears in SCOPe 2.03
  
• d3dwkc2 appears in SCOPe 2.05
  
• d3dwkc2 appears in the current release, SCOPe 2.08