Lineage for d3dwkb2 (3dwk B:293-692)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1690252Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1690253Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1690254Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1690846Protein Penicillin-binding protein 2, PBP2 [160970] (1 species)
  7. 1690847Species Staphylococcus aureus [TaxId:1280] [160971] (3 PDB entries)
    Uniprot Q2YY56 293-692
  8. 1690852Domain d3dwkb2: 3dwk B:293-692 [157916]
    Other proteins in same PDB: d3dwka1, d3dwkb1, d3dwkc1, d3dwkd1
    automated match to d2olua2
    complexed with lda, so4

Details for d3dwkb2

PDB Entry: 3dwk (more details), 3.1 Å

PDB Description: identification of dynamic structural motifs involved in peptidoglycan glycosyltransfer
PDB Compounds: (B:) Penicillin-binding protein 2

SCOPe Domain Sequences for d3dwkb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dwkb2 e.3.1.1 (B:293-692) Penicillin-binding protein 2, PBP2 {Staphylococcus aureus [TaxId: 1280]}
tnqdseynsyvnfvkselmnnkafkdenlgnvlqsgikiytnmdkdvqktlqndvdngsf
yknkdqqvgatildsktgglvaisggrdfkdvvnrnqatdphptgsslkpflaygpaien
mkwatnhaiqdessyqvdgstfrnydtkshgtvsiydalrqsfnipalkawqsvkqnagn
dapkkfaaklglnyegdigpsevlggsasefsptqlasafaaianggtynnahsiqkvvt
rdgetieydhtshkamsdytaymlaemlkgtfkpygsayghgvsgvnmgaktgtgtygae
tysqynlpdnaakdvwingftpqytmsvwmgfskvkqygensfvghsqqeypqflyenvm
skissrdgedfkrpssvsgsipsinvsgsqdnnttnrsth

SCOPe Domain Coordinates for d3dwkb2:

Click to download the PDB-style file with coordinates for d3dwkb2.
(The format of our PDB-style files is described here.)

Timeline for d3dwkb2: