SCOP 1.75: Domain d3dw8f1: 3dw8 F:6-293

Lineage for d3dw8f1 (3dw8 F:6-293)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (12 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.3: Protein serine/threonine phosphatase [56310] (5 proteins)

6. Protein Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha [143933] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [143934] (7 PDB entries)
   Uniprot P67775 2-294

8. Domain d3dw8f1: 3dw8 F:6-293 [157911]
   Other proteins in same PDB: d3dw8a1, d3dw8d1
   automatically matched to 2IE4 C:6-293
   complexed with acb, add, cab, mn; mutant

Details for d3dw8f1

PDB Entry: 3dw8, 2.85 Å

PDB Description: structure of a protein phosphatase 2a holoenzyme with b55 subunit

PDB Compounds: (F:) Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform

SCOP Domain Sequences for d3dw8f1:

Sequence; same for both SEQRES and ATOM records:

>d3dw8f1 d.159.1.3 (F:6-293) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]}
ftkeldqwieqlneckqlsesqvkslcekakeiltkesnvqevrcpvtvcgdvhgqfhdl
melfriggkspdtnylfmgdyvdrgyysvetvtllvalkvryreritilrgnhesrqitq
vygfydeclrkygnanvwkyftdlfdylpltalvdgqifclhgglspsidtldhiraldr
lqevphegpmcdllwsdpddrggwgisprgagytfgqdisetfnhangltlvsrahqlvm
egynwchdrnvvtifsapnycyrcgnqaaimelddtlkysflqfdpap

Timeline for d3dw8f1:

• d3dw8f1 is new in SCOP 1.75
  
• d3dw8f1 is called d3dw8f_ in SCOPe 2.01
  
• d3dw8f1 appears in the current release, SCOPe 2.08, called d3dw8f_