Lineage for d3dw8d2 (3dw8 D:9-589)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006480Family a.118.1.2: HEAT repeat [48385] (2 protein domains)
    Pfam PF02985
  6. 2006481Protein Constant regulatory domain of protein phosphatase 2a, pr65alpha [48386] (2 species)
  7. 2006482Species Human (Homo sapiens) [TaxId:9606] [48387] (12 PDB entries)
  8. 2006492Domain d3dw8d2: 3dw8 D:9-589 [157910]
    Other proteins in same PDB: d3dw8a3, d3dw8c_, d3dw8d3, d3dw8f_
    automated match to d1b3ua_
    complexed with mn

Details for d3dw8d2

PDB Entry: 3dw8 (more details), 2.85 Å

PDB Description: Structure of a Protein Phosphatase 2A Holoenzyme with B55 subunit
PDB Compounds: (D:) Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform

SCOPe Domain Sequences for d3dw8d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dw8d2 a.118.1.2 (D:9-589) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]}
slypiavlidelrnedvqlrlnsikklstialalgvertrsellpfltdtiydedevlla
laeqlgtfttlvggpeyvhcllppleslatveetvvrdkaveslraishehspsdleahf
vplvkrlaggdwftsrtsacglfsvcyprvssavkaelrqyfrnlcsddtpmvrraaask
lgefakvleldnvkseiipmfsnlasdeqdsvrllaveacvniaqllpqedlealvmptl
rqaaedkswrvrymvadkftelqkavgpeitktdlvpafqnlmkdceaevraaashkvke
fcenlsadcrenvimsqilpcikelvsdanqhvksalasvimglspilgkdntiehllpl
flaqlkdecpevrlniisnldcvnevigirqlsqsllpaivelaedakwrvrlaiieymp
llagqlgveffdeklnslcmawlvdhvyaireaatsnlkklvekfgkewahatiipkvla
msgdpnylhrmttlfcinvlsevcgqdittkhmlptvlrmagdpvanvrfnvakslqkig
pildnstlqsevkpilekltqdqdvdvkyfaqealtvlsla

SCOPe Domain Coordinates for d3dw8d2:

Click to download the PDB-style file with coordinates for d3dw8d2.
(The format of our PDB-style files is described here.)

Timeline for d3dw8d2: