![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
![]() | Superfamily d.159.1: Metallo-dependent phosphatases [56300] (12 families) ![]() different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
![]() | Family d.159.1.3: Protein serine/threonine phosphatase [56310] (5 proteins) |
![]() | Protein Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha [143933] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [143934] (7 PDB entries) Uniprot P67775 2-294 |
![]() | Domain d3dw8c1: 3dw8 C:6-293 [157909] Other proteins in same PDB: d3dw8a1, d3dw8d1 automatically matched to 2IE4 C:6-293 complexed with acb, add, cab, mn; mutant |
PDB Entry: 3dw8 (more details), 2.85 Å
SCOP Domain Sequences for d3dw8c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dw8c1 d.159.1.3 (C:6-293) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]} ftkeldqwieqlneckqlsesqvkslcekakeiltkesnvqevrcpvtvcgdvhgqfhdl melfriggkspdtnylfmgdyvdrgyysvetvtllvalkvryreritilrgnhesrqitq vygfydeclrkygnanvwkyftdlfdylpltalvdgqifclhgglspsidtldhiraldr lqevphegpmcdllwsdpddrggwgisprgagytfgqdisetfnhangltlvsrahqlvm egynwchdrnvvtifsapnycyrcgnqaaimelddtlkysflqfdpap
Timeline for d3dw8c1: