Lineage for d3dvub_ (3dvu B:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1955193Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 1955265Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 1955266Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 1955361Protein Bcl-2 homolog V-bcl-2 [144081] (1 species)
  7. 1955362Species Murid herpesvirus 4 [TaxId:33708] [144082] (3 PDB entries)
    Uniprot P89884 6-136
  8. 1955366Domain d3dvub_: 3dvu B: [157907]
    automated match to d2aboa1

Details for d3dvub_

PDB Entry: 3dvu (more details), 2.5 Å

PDB Description: crystal structure of the complex of murine gamma-herpesvirus 68 bcl-2 homolog m11 and the beclin 1 bh3 domain
PDB Compounds: (B:) V-bcl-2

SCOPe Domain Sequences for d3dvub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dvub_ f.1.4.1 (B:) Bcl-2 homolog V-bcl-2 {Murid herpesvirus 4 [TaxId: 33708]}
ksgtywatlitaflktvskveeldcvdsavlvdvskiitltqefrrhydsvyradygpal
knwkrdlsklftslfvdvinsgrivgffdvgryvceevlcpgswtedhellndcmthffi
ennlmnhfple

SCOPe Domain Coordinates for d3dvub_:

Click to download the PDB-style file with coordinates for d3dvub_.
(The format of our PDB-style files is described here.)

Timeline for d3dvub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3dvua_