SCOP 1.75: Domain d3dvub1: 3dvu B:6-134

Lineage for d3dvub1 (3dvu B:6-134)

1. Root: SCOP 1.75

2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (1 family)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (10 proteins)
   Pfam PF00452

6. Protein Bcl-2 homolog V-bcl-2 [144081] (1 species)

7. Species Murid herpesvirus 4 [TaxId:33708] [144082] (3 PDB entries)
   Uniprot P89884 6-136

8. Domain d3dvub1: 3dvu B:6-134 [157907]
   automatically matched to d2aboa1

Details for d3dvub1

PDB Entry: 3dvu, 2.5 Å

PDB Description: crystal structure of the complex of murine gamma-herpesvirus 68 bcl-2 homolog m11 and the beclin 1 bh3 domain

PDB Compounds: (B:) V-bcl-2

SCOP Domain Sequences for d3dvub1:

Sequence; same for both SEQRES and ATOM records:

>d3dvub1 f.1.4.1 (B:6-134) Bcl-2 homolog V-bcl-2 {Murid herpesvirus 4 [TaxId: 33708]}
sgtywatlitaflktvskveeldcvdsavlvdvskiitltqefrrhydsvyradygpalk
nwkrdlsklftslfvdvinsgrivgffdvgryvceevlcpgswtedhellndcmthffie
nnlmnhfpl

Timeline for d3dvub1:

• d3dvub1 is new in SCOP 1.75
  
• d3dvub1 is called d3dvub_ in SCOPe 2.01
  
• d3dvub1 appears in the current release, SCOPe 2.08, called d3dvub_