![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
![]() | Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) ![]() PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain |
![]() | Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins) Pfam PF00452 |
![]() | Protein Bcl-2 homolog V-bcl-2 [144081] (1 species) |
![]() | Species Murid herpesvirus 4 [TaxId:33708] [144082] (3 PDB entries) Uniprot P89884 6-136 |
![]() | Domain d3dvub_: 3dvu B: [157907] automated match to d2aboa1 |
PDB Entry: 3dvu (more details), 2.5 Å
SCOPe Domain Sequences for d3dvub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dvub_ f.1.4.1 (B:) Bcl-2 homolog V-bcl-2 {Murid herpesvirus 4 [TaxId: 33708]} ksgtywatlitaflktvskveeldcvdsavlvdvskiitltqefrrhydsvyradygpal knwkrdlsklftslfvdvinsgrivgffdvgryvceevlcpgswtedhellndcmthffi ennlmnhfple
Timeline for d3dvub_: