SCOPe 2.07: Domain d3dvua_: 3dvu A:

Lineage for d3dvua_ (3dvu A:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein Bcl-2 homolog V-bcl-2 [144081] (1 species)

7. Species Murid herpesvirus 4 [TaxId:33708] [144082] (3 PDB entries)
   Uniprot P89884 6-136

8. Domain d3dvua_: 3dvu A: [157906]
   automated match to d2aboa1

Details for d3dvua_

PDB Entry: 3dvu, 2.5 Å

PDB Description: crystal structure of the complex of murine gamma-herpesvirus 68 bcl-2 homolog m11 and the beclin 1 bh3 domain

PDB Compounds: (A:) V-bcl-2

SCOPe Domain Sequences for d3dvua_:

Sequence; same for both SEQRES and ATOM records:

>d3dvua_ f.1.4.1 (A:) Bcl-2 homolog V-bcl-2 {Murid herpesvirus 4 [TaxId: 33708]}
ksgtywatlitaflktvskveeldcvdsavlvdvskiitltqefrrhydsvyradygpal
knwkrdlsklftslfvdvinsgrivgffdvgryvceevlcpgswtedhellndcmthffi
ennlmnhfpl

Timeline for d3dvua_:

• d3dvua_ first appeared in SCOP 1.75, called d3dvua1
  
• d3dvua_ appears in SCOPe 2.06
  
• d3dvua_ appears in the current release, SCOPe 2.08