Lineage for d3dvnv_ (3dvn V:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2177212Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2177213Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2177487Protein Ubiquitin [54238] (8 species)
  7. 2177587Species Human (Homo sapiens) [TaxId:9606] [54239] (209 PDB entries)
    Uniprot P62988
    identical sequence in many other species
  8. 2177832Domain d3dvnv_: 3dvn V: [157903]
    Other proteins in same PDB: d3dvna1, d3dvna2, d3dvnb1, d3dvnb2, d3dvnh1, d3dvnh2, d3dvnl1, d3dvnl2, d3dvnu3, d3dvnx3
    automated match to d1aara_

Details for d3dvnv_

PDB Entry: 3dvn (more details), 2.7 Å

PDB Description: crystal structure of k63-specific fab apu2.16 bound to k63-linked di- ubiquitin
PDB Compounds: (V:) Ubiquitin

SCOPe Domain Sequences for d3dvnv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dvnv_ d.15.1.1 (V:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]}
mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
iqrestlhlvlrlrgg

SCOPe Domain Coordinates for d3dvnv_:

Click to download the PDB-style file with coordinates for d3dvnv_.
(The format of our PDB-style files is described here.)

Timeline for d3dvnv_: