Lineage for d3dvgb1 (3dvg B:2-120)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1755653Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1755830Species Human (Homo sapiens), cluster 3 [TaxId:9606] [88547] (33 PDB entries)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3)
  8. 1755863Domain d3dvgb1: 3dvg B:2-120 [157890]
    Other proteins in same PDB: d3dvga1, d3dvga2, d3dvgb2, d3dvgx_, d3dvgy_
    automatically matched to d1nl0h1

Details for d3dvgb1

PDB Entry: 3dvg (more details), 2.6 Å

PDB Description: crystal structure of k63-specific fab apu.3a8 bound to k63-linked di- ubiquitin
PDB Compounds: (B:) Human IgG1 fab fragment heavy chain

SCOPe Domain Sequences for d3dvgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dvgb1 b.1.1.1 (B:2-120) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]}
vqlvesggglvqpggslrlscaasgfnvktglihwvrqapgkglewvayitpyygstsya
dsvkgrftisadtskntaylqmnslraedtavyycareyyrwytaidywgqgtlvtvss

SCOPe Domain Coordinates for d3dvgb1:

Click to download the PDB-style file with coordinates for d3dvgb1.
(The format of our PDB-style files is described here.)

Timeline for d3dvgb1: