SCOP 1.75: Domain d3dvgb1: 3dvg B:2-120

Lineage for d3dvgb1 (3dvg B:2-120)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 3 [TaxId:9606] [88547] (33 PDB entries)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3)

8. Domain d3dvgb1: 3dvg B:2-120 [157890]
   Other proteins in same PDB: d3dvga1, d3dvga2, d3dvgb2, d3dvgx1, d3dvgy1
   automatically matched to d1nl0h1
   mutant

Details for d3dvgb1

PDB Entry: 3dvg, 2.6 Å

PDB Description: crystal structure of k63-specific fab apu.3a8 bound to k63-linked di- ubiquitin

PDB Compounds: (B:) Human IgG1 fab fragment heavy chain

SCOP Domain Sequences for d3dvgb1:

Sequence; same for both SEQRES and ATOM records:

>d3dvgb1 b.1.1.1 (B:2-120) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]}
vqlvesggglvqpggslrlscaasgfnvktglihwvrqapgkglewvayitpyygstsya
dsvkgrftisadtskntaylqmnslraedtavyycareyyrwytaidywgqgtlvtvss

Timeline for d3dvgb1:

• d3dvgb1 is new in SCOP 1.75
  
• d3dvgb1 appears in SCOPe 2.01
  
• d3dvgb1 appears in the current release, SCOPe 2.08