Lineage for d3dvga2 (3dvg A:110-214)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2360179Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 2360180Species Human (Homo sapiens) [TaxId:9606] [88569] (151 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody
  8. 2360273Domain d3dvga2: 3dvg A:110-214 [157889]
    Other proteins in same PDB: d3dvga1, d3dvgb1, d3dvgb2, d3dvgx2, d3dvgx3, d3dvgy_
    automatically matched to d1g9ml2

Details for d3dvga2

PDB Entry: 3dvg (more details), 2.6 Å

PDB Description: crystal structure of k63-specific fab apu.3a8 bound to k63-linked di- ubiquitin
PDB Compounds: (A:) Human IgG1 fab fragment light chain

SCOPe Domain Sequences for d3dvga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dvga2 b.1.1.2 (A:110-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d3dvga2:

Click to download the PDB-style file with coordinates for d3dvga2.
(The format of our PDB-style files is described here.)

Timeline for d3dvga2: