Lineage for d3dvga1 (3dvg A:5-109)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 782637Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 782793Species Human (Homo sapiens), cluster 3.2 [TaxId:9606] [88523] (35 PDB entries)
  8. 782842Domain d3dvga1: 3dvg A:5-109 [157888]
    Other proteins in same PDB: d3dvga2, d3dvgb1, d3dvgb2, d3dvgx1, d3dvgy1
    automatically matched to d1g9ml1
    mutant

Details for d3dvga1

PDB Entry: 3dvg (more details), 2.6 Å

PDB Description: Crystal structure of K63-specific fab Apu.3A8 bound to K63-linked di-ubiquitin
PDB Compounds: (A:) Human IgG1 fab fragment light chain

SCOP Domain Sequences for d3dvga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dvga1 b.1.1.1 (A:5-109) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]}
tqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysarslysgvpsrfsg
srsgtdftltisslqpedfatyycqqyssysslftfgqgtkveik

SCOP Domain Coordinates for d3dvga1:

Click to download the PDB-style file with coordinates for d3dvga1.
(The format of our PDB-style files is described here.)

Timeline for d3dvga1: