SCOPe 2.05: Domain d3duhb3: 3duh B:212-305

Lineage for d3duhb3 (3duh B:212-305)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 [63672] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63673] (5 PDB entries)

8. Domain d3duhb3: 3duh B:212-305 [157887]
   Other proteins in same PDB: d3duha1, d3duhb1
   automatically matched to d1f42a3
   complexed with nag

Details for d3duhb3

PDB Entry: 3duh, 2.3 Å

PDB Description: structure of interleukin-23

PDB Compounds: (B:) Interleukin-12 subunit beta

SCOPe Domain Sequences for d3duhb3:

Sequence, based on SEQRES records:

>d3duhb3 b.1.2.1 (B:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}
kpdppknlqlkplknsrqvevsweypdtwstphsyfsltfcvqvqgkskrekkdrvftdk
tsatvicrknasisvraqdryyssswsewasvpc

Sequence, based on observed residues (ATOM records):

>d3duhb3 b.1.2.1 (B:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}
kpdppknlqlkplqvevsweypdtwstphsyfsltfcvqvqgkkkdrvftdktsatvicr
knasisvraqdryyssswsewasvpc

Timeline for d3duhb3:

• d3duhb3 first appeared in SCOP 1.75
  
• d3duhb3 appears in SCOPe 2.04
  
• d3duhb3 appears in SCOPe 2.06
  
• d3duhb3 appears in the current release, SCOPe 2.08