Lineage for d3duha3 (3duh A:212-306)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2762136Protein The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 [63672] (1 species)
  7. 2762137Species Human (Homo sapiens) [TaxId:9606] [63673] (5 PDB entries)
  8. 2762141Domain d3duha3: 3duh A:212-306 [157884]
    Other proteins in same PDB: d3duha1, d3duha4, d3duhb1, d3duhb4
    automatically matched to d1f42a3
    complexed with nag

Details for d3duha3

PDB Entry: 3duh (more details), 2.3 Å

PDB Description: structure of interleukin-23
PDB Compounds: (A:) Interleukin-12 subunit beta

SCOPe Domain Sequences for d3duha3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3duha3 b.1.2.1 (A:212-306) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}
kpdppknlqlkplknsrqvevsweypdtwstphsyfsltfcvqvqgkskrekkdrvftdk
tsatvicrknasisvraqdryyssswsewasvpcs

SCOPe Domain Coordinates for d3duha3:

Click to download the PDB-style file with coordinates for d3duha3.
(The format of our PDB-style files is described here.)

Timeline for d3duha3: