Lineage for d3duha1 (3duh A:1-87)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753913Protein The p40 domain of interleukin-12 (IL-12 beta chain), N-terminal domain [63665] (1 species)
  7. 2753914Species Human (Homo sapiens) [TaxId:9606] [63666] (5 PDB entries)
  8. 2753916Domain d3duha1: 3duh A:1-87 [157882]
    Other proteins in same PDB: d3duha2, d3duha3, d3duha4, d3duhb2, d3duhb3, d3duhb4
    automatically matched to d1f42a1
    complexed with nag

Details for d3duha1

PDB Entry: 3duh (more details), 2.3 Å

PDB Description: structure of interleukin-23
PDB Compounds: (A:) Interleukin-12 subunit beta

SCOPe Domain Sequences for d3duha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3duha1 b.1.1.4 (A:1-87) The p40 domain of interleukin-12 (IL-12 beta chain), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
iwelkkdvyvveldwypdapgemvvltcdtpeedgitwtldqssevlgsgktltiqvkef
gdagqytchkggevlshsllllhkked

SCOPe Domain Coordinates for d3duha1:

Click to download the PDB-style file with coordinates for d3duha1.
(The format of our PDB-style files is described here.)

Timeline for d3duha1: