![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) ![]() the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
![]() | Family c.1.9.18: Zn-dependent arginine carboxypeptidase-like [159408] (3 proteins) automatically mapped to Pfam PF01979 |
![]() | Protein Zn-dependent arginine carboxypeptidase [159411] (1 species) |
![]() | Species Unidentified organism [TaxId:32644] [159412] (2 PDB entries) |
![]() | Domain d3duge2: 3dug E:57-359 [157875] Other proteins in same PDB: d3duga1, d3dugb1, d3dugc1, d3dugd1, d3duge1, d3dugf1, d3dugg1, d3dugh1 automatically matched to 3BE7 A:57-359 complexed with arg, gol, zn |
PDB Entry: 3dug (more details), 2.62 Å
SCOPe Domain Sequences for d3duge2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3duge2 c.1.9.18 (E:57-359) Zn-dependent arginine carboxypeptidase {Unidentified organism [TaxId: 32644]} glmdshvhivgndskgeesiadsshmgtvwgvvnaektlmagfttvrnvgaanyadvsvr daiergvingptmlvsgpalgitgghcdhnllppefnyssegvvdspwearkmvrknrky gadlikfcatggvmsrntdvnakqftleemkaivdeahnhgmkvaahahgligikaaika gvdsvehasfiddetidmaiknntvlsmdifvsdyilgegakagireeslnkerlvgkkq renfmnahrrgaiitfgtdagifdhgdnakqfaymvewgmtpleaiqastiktatlfgie nig
Timeline for d3duge2: