SCOPe 2.06: Domain d3dugd1: 3dug D:5-56,D:360-398

Lineage for d3dugd1 (3dug D:5-56,D:360-398)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
   pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families)
   this domain is interrupted by the catalytic beta/alpha barrel domain

5. Family b.92.1.9: Zn-dependent arginine carboxypeptidase-like [159340] (3 proteins)

6. Protein Zn-dependent arginine carboxypeptidase [159343] (1 species)

7. Species Unidentified organism [TaxId:32644] [159344] (2 PDB entries)

8. Domain d3dugd1: 3dug D:5-56,D:360-398 [157872]
   Other proteins in same PDB: d3duga2, d3dugb2, d3dugc2, d3dugd2, d3duge2, d3dugf2, d3dugg2, d3dugh2
   automatically matched to 3BE7 A:3-56,A:360-400
   complexed with arg, gol, zn

Details for d3dugd1

PDB Entry: 3dug, 2.62 Å

PDB Description: crystal structure of zn-dependent arginine carboxypeptidase complexed with zinc

PDB Compounds: (D:) Zn-dependent arginine carboxypeptidase

SCOPe Domain Sequences for d3dugd1:

Sequence; same for both SEQRES and ATOM records:

>d3dugd1 b.92.1.9 (D:5-56,D:360-398) Zn-dependent arginine carboxypeptidase {Unidentified organism [TaxId: 32644]}
dflikskgyldiqtgeiikadllirngkiaeigkintkdatvisipdlilipXqikegfd
adivgvienplanirtleevafvmkegkvykr

Timeline for d3dugd1:

• d3dugd1 first appeared in SCOP 1.75
  
• d3dugd1 appears in SCOPe 2.05
  
• d3dugd1 appears in SCOPe 2.07
  
• d3dugd1 appears in the current release, SCOPe 2.08