SCOPe 2.08: Domain d3du7e1: 3du7 E:5-141

Lineage for d3du7e1 (3du7 E:5-141)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.137.10: Stathmin [101494] (1 family)
   single long helix crosslinking four tubulin subunits
   automatically mapped to Pfam PF00836

5. Family a.137.10.1: Stathmin [101495] (2 proteins)

6. Protein Stathmin 4 [101496] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries)

8. Domain d3du7e1: 3du7 E:5-141 [157864]
   Other proteins in same PDB: d3du7a1, d3du7b1, d3du7e2
   automatically matched to d1sa0e_
   complexed with cn2, gtp, hos, mg

Details for d3du7e1

PDB Entry: 3du7, 4.1 Å

PDB Description: Tubulin-colchicine-phomopsin A: Stathmin-like domain complex

PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d3du7e1:

Sequence, based on SEQRES records:

>d3du7e1 a.137.10.1 (E:5-141) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dmevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyq
eaellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlq
ekdkhaeevrknkelke

Sequence, based on observed residues (ATOM records):

>d3du7e1 a.137.10.1 (E:5-141) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dmevielnkctsgqsfevilkppssleeiqkkleaaeerrkyqeaellkhlaekrehere
viqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelke

Timeline for d3du7e1:

• d3du7e1 first appeared in SCOP 1.75
  
• d3du7e1 appears in SCOPe 2.07