Lineage for d3du7b1 (3du7 B:2-437)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 898313Fold i.10: Microtubule complexes [58193] (1 superfamily)
  4. 898314Superfamily i.10.1: Microtubule complexes [58194] (1 family) (S)
  5. 898315Family i.10.1.1: Microtubule complexes [58195] (2 proteins)
  6. 898321Protein Tubulin:stathmin-like domain complex [58196] (2 species)
  7. 898322Species Cow (Bos taurus) [TaxId:9913] [161286] (2 PDB entries)
  8. 898324Domain d3du7b1: 3du7 B:2-437 [157863]
    Other proteins in same PDB: d3du7e1
    automatically matched to d1ffxb_
    complexed with cn2, gdp, gtp, hos, mg

Details for d3du7b1

PDB Entry: 3du7 (more details), 4.1 Å

PDB Description: Tubulin-colchicine-phomopsin A: Stathmin-like domain complex
PDB Compounds: (B:) Tubulin beta-2B chain

SCOP Domain Sequences for d3du7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3du7b1 i.10.1.1 (B:2-437) Tubulin:stathmin-like domain complex {Cow (Bos taurus) [TaxId: 9913]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve
pynatlsvhqlventdetysidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fpgqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmma
acdprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprgl
kmsatfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvse
yqqyqd

SCOP Domain Coordinates for d3du7b1:

Click to download the PDB-style file with coordinates for d3du7b1.
(The format of our PDB-style files is described here.)

Timeline for d3du7b1: