Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) |
Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins) |
Protein Bacterial aa3 type cytochrome c oxidase subunit II [81458] (2 species) |
Species Rhodobacter sphaeroides [TaxId:1063] [81457] (7 PDB entries) |
Domain d3dtud2: 3dtu D:28-129 [157861] Other proteins in same PDB: d3dtua_, d3dtub1, d3dtub3, d3dtuc_, d3dtud1, d3dtud3 automated match to d3fyeb1 complexed with ca, cd, cu, dmu, dxc, hea, hto, mg, oh, po4, trd |
PDB Entry: 3dtu (more details), 2.15 Å
SCOPe Domain Sequences for d3dtud2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dtud2 f.17.2.1 (D:28-129) Bacterial aa3 type cytochrome c oxidase subunit II {Rhodobacter sphaeroides [TaxId: 1063]} qsleiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhekr nkvparfthnspleiawtivpivilvaigafslpvlfnqqei
Timeline for d3dtud2: