Class b: All beta proteins [48724] (178 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins) |
Protein Cytochrome c oxidase [49544] (4 species) |
Species Rhodobacter sphaeroides [TaxId:1063] [74870] (7 PDB entries) |
Domain d3dtud1: 3dtu D:130-281 [157860] Other proteins in same PDB: d3dtua_, d3dtub2, d3dtub3, d3dtuc_, d3dtud2, d3dtud3 automated match to d3fyeb2 complexed with ca, cd, cu, dmu, dxc, hea, hto, mg, oh, po4, trd |
PDB Entry: 3dtu (more details), 2.15 Å
SCOPe Domain Sequences for d3dtud1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dtud1 b.6.1.2 (D:130-281) Cytochrome c oxidase {Rhodobacter sphaeroides [TaxId: 1063]} peadvtvkvtgyqwywgyeypdeeisfesymigspatggdnrmspeveqqlieagysrde fllatdtamvvpvnktvvvqvtgadvihswtvpafgvkqdavpgrlaqlwfraeregiff gqcselcgishaympitvkvvseeayaawleq
Timeline for d3dtud1: