Lineage for d3dtpc1 (3dtp C:3-150)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768455Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 768456Superfamily a.39.1: EF-hand [47473] (11 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 768689Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
    Duplication: made with two pairs of EF-hands
  6. 768986Protein Myosin Essential Chain [47524] (3 species)
  7. 769002Species Chicken (Gallus gallus) [TaxId:9031] [47526] (4 PDB entries)
  8. 769012Domain d3dtpc1: 3dtp C:3-150 [157854]
    automatically matched to d1br1b_

Details for d3dtpc1

PDB Entry: 3dtp (more details), 20 Å

PDB Description: tarantula heavy meromyosin obtained by flexible docking to tarantula muscle thick filament cryo-em 3d-map
PDB Compounds: (C:) Smooth muscle myosin essential light chain

SCOP Domain Sequences for d3dtpc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dtpc1 a.39.1.5 (C:3-150) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]}
fseeqtaefkeafqlfdrtgdgkilysqcgdvmralgqnptnaevmkvlgnpksdemnlk
tlkfeqflpmmqtiaknkdqgcfedyveglrvfdkegngtvmgaeirhvlvtlgekmtee
eveqlvaghedsngcinyeelvrmvlsg

SCOP Domain Coordinates for d3dtpc1:

Click to download the PDB-style file with coordinates for d3dtpc1.
(The format of our PDB-style files is described here.)

Timeline for d3dtpc1:

View in 3D
Domains from other chains:
(mouse over for more information)
d3dtpd1