Class a: All alpha proteins [46456] (284 folds) |
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (5 families) |
Family a.211.1.1: HD domain [101340] (13 proteins) Pfam PF01966; metal dependent phosphohydrolases |
Protein Uncharacterized protein BH2835 [158727] (1 species) |
Species Bacillus halodurans [TaxId:86665] [158728] (1 PDB entry) Uniprot Q9K916 2-213 |
Domain d3dtod1: 3dto D:2-213 [157853] automatically matched to 3DTO A:2-213 |
PDB Entry: 3dto (more details), 3.3 Å
SCOP Domain Sequences for d3dtod1:
Sequence, based on SEQRES records: (download)
>d3dtod1 a.211.1.1 (D:2-213) Uncharacterized protein BH2835 {Bacillus halodurans [TaxId: 86665]} neqailqsaeawvkkqlmdeysghdwyhirrvtlmakaigeqekvdvfvvqiaalfhdli ddklvddpetakqqlidwmeaagvpsqkidhtmdiintisfkgghgqslatreamvvqda drldalgaigiartfaysgnkgqpiydpelpiretmtveeyrhgkstainhfyeklfklk dlmntetgkqlakerhvfmeqfierflsewng
>d3dtod1 a.211.1.1 (D:2-213) Uncharacterized protein BH2835 {Bacillus halodurans [TaxId: 86665]} neqailqsaeawvkkqlmdedwyhirrvtlmakaigeqekvdvfvvqiaalfhdlideta kqqlidwmeaagvpsqkidhtmdiintiatreamvvqdadrldalgaigiartfaysgnk gqpiydpelpirmtveeyrhgkstainhfyeklfklkdlmntetgkqlakerhvfmeqfi erflsewng
Timeline for d3dtod1: