SCOP 1.75: Domain d3dtod1: 3dto D:2-213

Lineage for d3dtod1 (3dto D:2-213)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (5 families)

5. Family a.211.1.1: HD domain [101340] (13 proteins)
   Pfam PF01966; metal dependent phosphohydrolases

6. Protein Uncharacterized protein BH2835 [158727] (1 species)

7. Species Bacillus halodurans [TaxId:86665] [158728] (1 PDB entry)
   Uniprot Q9K916 2-213

8. Domain d3dtod1: 3dto D:2-213 [157853]
   automatically matched to 3DTO A:2-213

Details for d3dtod1

PDB Entry: 3dto, 3.3 Å

PDB Description: Crystal structure of the metal-dependent HD domain-containing hydrolase BH2835 from Bacillus halodurans, Northeast Structural Genomics Consortium Target BhR130.

PDB Compounds: (D:) BH2835 protein

SCOP Domain Sequences for d3dtod1:

Sequence, based on SEQRES records:

>d3dtod1 a.211.1.1 (D:2-213) Uncharacterized protein BH2835 {Bacillus halodurans [TaxId: 86665]}
neqailqsaeawvkkqlmdeysghdwyhirrvtlmakaigeqekvdvfvvqiaalfhdli
ddklvddpetakqqlidwmeaagvpsqkidhtmdiintisfkgghgqslatreamvvqda
drldalgaigiartfaysgnkgqpiydpelpiretmtveeyrhgkstainhfyeklfklk
dlmntetgkqlakerhvfmeqfierflsewng

Sequence, based on observed residues (ATOM records):

>d3dtod1 a.211.1.1 (D:2-213) Uncharacterized protein BH2835 {Bacillus halodurans [TaxId: 86665]}
neqailqsaeawvkkqlmdedwyhirrvtlmakaigeqekvdvfvvqiaalfhdlideta
kqqlidwmeaagvpsqkidhtmdiintiatreamvvqdadrldalgaigiartfaysgnk
gqpiydpelpirmtveeyrhgkstainhfyeklfklkdlmntetgkqlakerhvfmeqfi
erflsewng

Timeline for d3dtod1:

• d3dtod1 is new in SCOP 1.75
  
• d3dtod1 appears in SCOPe 2.01
  
• d3dtod1 appears in the current release, SCOPe 2.08