Lineage for d3dtoc1 (3dto C:2-213)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736615Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2736616Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. 2736617Family a.211.1.1: HD domain [101340] (15 proteins)
    Pfam PF01966; metal dependent phosphohydrolases
  6. 2736676Protein Uncharacterized protein BH2835 [158727] (1 species)
  7. 2736677Species Bacillus halodurans [TaxId:86665] [158728] (1 PDB entry)
    Uniprot Q9K916 2-213
  8. 2736680Domain d3dtoc1: 3dto C:2-213 [157852]
    automatically matched to 3DTO A:2-213

Details for d3dtoc1

PDB Entry: 3dto (more details), 3.3 Å

PDB Description: Crystal structure of the metal-dependent HD domain-containing hydrolase BH2835 from Bacillus halodurans, Northeast Structural Genomics Consortium Target BhR130.
PDB Compounds: (C:) BH2835 protein

SCOPe Domain Sequences for d3dtoc1:

Sequence, based on SEQRES records: (download)

>d3dtoc1 a.211.1.1 (C:2-213) Uncharacterized protein BH2835 {Bacillus halodurans [TaxId: 86665]}
neqailqsaeawvkkqlmdeysghdwyhirrvtlmakaigeqekvdvfvvqiaalfhdli
ddklvddpetakqqlidwmeaagvpsqkidhtmdiintisfkgghgqslatreamvvqda
drldalgaigiartfaysgnkgqpiydpelpiretmtveeyrhgkstainhfyeklfklk
dlmntetgkqlakerhvfmeqfierflsewng

Sequence, based on observed residues (ATOM records): (download)

>d3dtoc1 a.211.1.1 (C:2-213) Uncharacterized protein BH2835 {Bacillus halodurans [TaxId: 86665]}
neqailqsaeawvkkqlmdedwyhirrvtlmakaigeqekvdvfvvqiaalfhdlideta
kqqlidwmeaagvpsqkidhtmdiintiatreamvvqdadrldalgaigiartfaysgnk
gqpiydpelpirmtveeyrhgkstainhfyeklfklkdlmntetgkqlakerhvfmeqfi
erflsewng

SCOPe Domain Coordinates for d3dtoc1:

Click to download the PDB-style file with coordinates for d3dtoc1.
(The format of our PDB-style files is described here.)

Timeline for d3dtoc1: