![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
![]() | Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) ![]() |
![]() | Family a.211.1.1: HD domain [101340] (15 proteins) Pfam PF01966; metal dependent phosphohydrolases |
![]() | Protein Uncharacterized protein BH2835 [158727] (1 species) |
![]() | Species Bacillus halodurans [TaxId:86665] [158728] (1 PDB entry) Uniprot Q9K916 2-213 |
![]() | Domain d3dtoc1: 3dto C:2-213 [157852] automatically matched to 3DTO A:2-213 |
PDB Entry: 3dto (more details), 3.3 Å
SCOPe Domain Sequences for d3dtoc1:
Sequence, based on SEQRES records: (download)
>d3dtoc1 a.211.1.1 (C:2-213) Uncharacterized protein BH2835 {Bacillus halodurans [TaxId: 86665]} neqailqsaeawvkkqlmdeysghdwyhirrvtlmakaigeqekvdvfvvqiaalfhdli ddklvddpetakqqlidwmeaagvpsqkidhtmdiintisfkgghgqslatreamvvqda drldalgaigiartfaysgnkgqpiydpelpiretmtveeyrhgkstainhfyeklfklk dlmntetgkqlakerhvfmeqfierflsewng
>d3dtoc1 a.211.1.1 (C:2-213) Uncharacterized protein BH2835 {Bacillus halodurans [TaxId: 86665]} neqailqsaeawvkkqlmdedwyhirrvtlmakaigeqekvdvfvvqiaalfhdlideta kqqlidwmeaagvpsqkidhtmdiintiatreamvvqdadrldalgaigiartfaysgnk gqpiydpelpirmtveeyrhgkstainhfyeklfklkdlmntetgkqlakerhvfmeqfi erflsewng
Timeline for d3dtoc1: