Lineage for d3dsvb_ (3dsv B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004426Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2004554Family a.102.4.3: Protein prenyltransferases [48246] (3 protein domains)
  6. 2004671Protein Rab geranylgeranyltransferase, beta subunit [48249] (1 species)
  7. 2004672Species Norway rat (Rattus norvegicus) [TaxId:10116] [48250] (21 PDB entries)
  8. 2004681Domain d3dsvb_: 3dsv B: [157844]
    automated match to d1dceb_
    complexed with ca, ger, zn

Details for d3dsvb_

PDB Entry: 3dsv (more details), 2.1 Å

PDB Description: crystal structure of rabggtase(delta lrr; delta ig)in complex with mono-prenylated peptide ser-cys-ser-cys(gg) derivated from rab7
PDB Compounds: (B:) Geranylgeranyl transferase type-2 subunit beta

SCOPe Domain Sequences for d3dsvb_:

Sequence, based on SEQRES records: (download)

>d3dsvb_ a.102.4.3 (B:) Rab geranylgeranyltransferase, beta subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qkdvtiksdapdtlllekhadyiasygskkddyeycmseylrmsgvywgltvmdlmgqlh
rmnkeeilvfikscqhecggvsasighdphllytlsavqiltlydsihvinvdkvvayvq
slqkedgsfagdiwgeidtrfsfcavatlallgkldainvekaiefvlscmnfdggfgcr
pgseshagqiycctgflaitsqlhqvnsdllgwwlcerqlpsgglngrpeklpdvcysww
vlaslkiigrlhwidreklrsfilacqdeetggfadrpgdmvdpfhtlfgiaglsllgee
qikpvspvfcmpeevlqrvnvqpelvs

Sequence, based on observed residues (ATOM records): (download)

>d3dsvb_ a.102.4.3 (B:) Rab geranylgeranyltransferase, beta subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qkdvtiksdapdtlllekhadyiasygsdyeycmseylrmsgvywgltvmdlmgqlhrmn
keeilvfikscqhecggvsasighdphllytlsavqiltlydsihvinvdkvvayvqslq
kedgsfagdiwgeidtrfsfcavatlallgkldainvekaiefvlscmnfdggfgcrpgs
eshagqiycctgflaitsqlhqvnsdllgwwlcerqlpsgglngrpeklpdvcyswwvla
slkiigrlhwidreklrsfilacqdeetggfadrpgdmvdpfhtlfgiaglsllgeeqik
pvspvfcmpeevlqrvnvqpelvs

SCOPe Domain Coordinates for d3dsvb_:

Click to download the PDB-style file with coordinates for d3dsvb_.
(The format of our PDB-style files is described here.)

Timeline for d3dsvb_: