Lineage for d3dssb_ (3dss B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1498423Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 1498779Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 1498907Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins)
  6. 1499024Protein Rab geranylgeranyltransferase, beta subunit [48249] (1 species)
  7. 1499025Species Norway rat (Rattus norvegicus) [TaxId:10116] [48250] (21 PDB entries)
  8. 1499026Domain d3dssb_: 3dss B: [157841]
    automated match to d1dceb_
    complexed with ca, zn

Details for d3dssb_

PDB Entry: 3dss (more details), 1.8 Å

PDB Description: crystal structure of rabggtase(delta lrr; delta ig)
PDB Compounds: (B:) Geranylgeranyl transferase type-2 subunit beta

SCOPe Domain Sequences for d3dssb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dssb_ a.102.4.3 (B:) Rab geranylgeranyltransferase, beta subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qkdvtiksdapdtlllekhadyiasygskkddyeycmseylrmsgvywgltvmdlmgqlh
rmnkeeilvfikscqhecggvsasighdphllytlsavqiltlydsihvinvdkvvayvq
slqkedgsfagdiwgeidtrfsfcavatlallgkldainvekaiefvlscmnfdggfgcr
pgseshagqiycctgflaitsqlhqvnsdllgwwlcerqlpsgglngrpeklpdvcysww
vlaslkiigrlhwidreklrsfilacqdeetggfadrpgdmvdpfhtlfgiaglsllgee
qikpvspvfcmpeevlqrvnvqpelvs

SCOPe Domain Coordinates for d3dssb_:

Click to download the PDB-style file with coordinates for d3dssb_.
(The format of our PDB-style files is described here.)

Timeline for d3dssb_: