Lineage for d3dsca1 (3dsc A:1-333)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 876798Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 876799Superfamily d.159.1: Metallo-dependent phosphatases [56300] (12 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 876908Family d.159.1.4: DNA double-strand break repair nuclease [64427] (1 protein)
    contains C-terminal alpha/beta subdomain
  6. 876909Protein Mre11 [64428] (1 species)
  7. 876910Species Archaeon Pyrococcus furiosus [TaxId:2261] [64429] (3 PDB entries)
    Uniprot Q8U1N9
  8. 876915Domain d3dsca1: 3dsc A:1-333 [157840]
    automatically matched to d1ii7a_

Details for d3dsca1

PDB Entry: 3dsc (more details), 2.7 Å

PDB Description: crystal structure of p. furiosus mre11 dna synaptic complex
PDB Compounds: (A:) DNA double-strand break repair protein mre11

SCOP Domain Sequences for d3dsca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dsca1 d.159.1.4 (A:1-333) Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]}
mkfahladihlgyeqfhkpqreeefaeafknaleiavqenvdfiliagdlfhssrpspgt
lkkaiallqipkehsipvfaiegnhdrtqrgpsvlnlledfglvyvigmrkekveneylt
serlgngeylvkgvykdleihgmkymssawfeankeilkrlfrptdnailmlhqgvrevs
eargedyfeiglgdlpegylyyalghihkryetsysgspvvypgslerwdfgdyevryew
dgikfkerygvnkgfyivedfkprfveikvrpfidvkikgseeeirkaikrliplipkna
yvrlnigwrkpfdlteikellnveylkidtwri

SCOP Domain Coordinates for d3dsca1:

Click to download the PDB-style file with coordinates for d3dsca1.
(The format of our PDB-style files is described here.)

Timeline for d3dsca1: