SCOP 1.75: Domain d3ds6c1: 3ds6 C:4-352

Lineage for d3ds6c1 (3ds6 C:4-352)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein MAP kinase p38 [56129] (2 species)
   CMGC group; ERK/MAPK subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [56130] (60 PDB entries)

8. Domain d3ds6c1: 3ds6 C:4-352 [157838]
   automatically matched to d1a9ua_
   complexed with a17; mutant

Details for d3ds6c1

PDB Entry: 3ds6, 2.9 Å

PDB Description: P38 complex with a phthalazine inhibitor

PDB Compounds: (C:) Mitogen-activated protein kinase 14

SCOP Domain Sequences for d3ds6c1:

Sequence; same for both SEQRES and ATOM records:

>d3ds6c1 d.144.1.7 (C:4-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]}
erptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsii
hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqklt
ddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyv
atrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpg
aellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqal
ahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvppp

Timeline for d3ds6c1:

• d3ds6c1 is new in SCOP 1.75
  
• d3ds6c1 is called d3ds6c_ in SCOPe 2.01
  
• d3ds6c1 appears in the current release, SCOPe 2.08, called d3ds6c_