Lineage for d3ds6a_ (3ds6 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1930891Protein MAP kinase p38 [56129] (2 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. 1930892Species Human (Homo sapiens) [TaxId:9606] [56130] (162 PDB entries)
  8. 1931059Domain d3ds6a_: 3ds6 A: [157836]
    automated match to d1a9ua_
    complexed with a17

Details for d3ds6a_

PDB Entry: 3ds6 (more details), 2.9 Å

PDB Description: P38 complex with a phthalazine inhibitor
PDB Compounds: (A:) Mitogen-activated protein kinase 14

SCOPe Domain Sequences for d3ds6a_:

Sequence, based on SEQRES records: (download)

>d3ds6a_ d.144.1.7 (A:) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]}
erptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsii
hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqklt
ddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyv
atrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpg
aellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqal
ahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvppp

Sequence, based on observed residues (ATOM records): (download)

>d3ds6a_ d.144.1.7 (A:) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]}
erptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsii
hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqklt
ddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtdvatrwyr
apeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkk
issesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfa
qyhdpddepvadpydqsfesrdllidewksltydevisfvppp

SCOPe Domain Coordinates for d3ds6a_:

Click to download the PDB-style file with coordinates for d3ds6a_.
(The format of our PDB-style files is described here.)

Timeline for d3ds6a_: