Lineage for d3dpyb1 (3dpy B:22-423)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1276656Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 1276995Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 1277123Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins)
  6. 1277124Protein Protein farnesyltransferase, beta-subunit [48247] (3 species)
  7. 1277141Species Norway rat (Rattus norvegicus) [TaxId:10116] [48248] (49 PDB entries)
    Uniprot Q02293 22-418 P53610
  8. 1277188Domain d3dpyb1: 3dpy B:22-423 [157826]
    Other proteins in same PDB: d3dpya1
    automatically matched to d1ft1b_
    complexed with acy, fpp, zn

Details for d3dpyb1

PDB Entry: 3dpy (more details), 2.7 Å

PDB Description: Protein farnesyltransferase complexed with FPP and caged TKCVIM substrate
PDB Compounds: (B:) Protein farnesyltransferase subunit beta

SCOPe Domain Sequences for d3dpyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dpyb1 a.102.4.3 (B:22-423) Protein farnesyltransferase, beta-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
plyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqrekhfhy
lkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspdggfg
ggpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvggevdv
rsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalvi
lkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgdp
alsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsgam
lhdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgf

SCOPe Domain Coordinates for d3dpyb1:

Click to download the PDB-style file with coordinates for d3dpyb1.
(The format of our PDB-style files is described here.)

Timeline for d3dpyb1: