SCOP 1.75: Domain d3dplr1: 3dpl R:19-106

Lineage for d3dplr1 (3dpl R:19-106)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (6 families)

5. Family g.44.1.1: RING finger domain, C3HC4 [57851] (14 proteins)

6. Protein RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex [75693] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75694] (6 PDB entries)
   Uniprot P62877 19-106

8. Domain d3dplr1: 3dpl R:19-106 [157824]
   automatically matched to d1ldjb_
   complexed with zn; mutant

Details for d3dplr1

PDB Entry: 3dpl, 2.6 Å

PDB Description: structural insights into nedd8 activation of cullin-ring ligases: conformational control of conjugation.

PDB Compounds: (R:) RING-box protein 1

SCOP Domain Sequences for d3dplr1:

Sequence, based on SEQRES records:

>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]}
kkrfevkkwnavalwawdivvdncaicrnhimdlciecqanqasatseectvawgvcnha
fhfhcisrwlktrqvcpldnrewefqky

Sequence, based on observed residues (ATOM records):

>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]}
kkrfevkkwnavalwawdivvdncaicrnhimdlciecqanqasaectvawgvcnhafhf
hcisrwlktrqvcpldnrewefqky

Timeline for d3dplr1:

• d3dplr1 is new in SCOP 1.75
  
• d3dplr1 is called d3dplr_ in SCOPe 2.01
  
• d3dplr1 appears in the current release, SCOPe 2.08, called d3dplr_